HORDB

ID: hor004677
Uniprot ID: B3H5J1(76-88)
Protein name: Root meristem growth factor 5
Gene name: GLV10
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: RGF family
Source: Plant
Expression: In roots, expressed only in the quiescent center (QC) and the columella stem cells (CC) initials . |Expressed in roots, shoots, leaves and flowers.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005515 protein binding; GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0009786 regulation of asymmetric cell division; GO:0010082 regulation of root meristem growth; GO:0022622 root system development; GO:0030154 cell differentiation; GO:0048527 lateral root development; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005783 endoplasmic reticulum

Sequence: DYPKPSTRPPRHN
Length: 13(76-88)
Propeptide: MSSIHVASMILLLFLFLHHSDSRHLDNVHITASRFSLVKDQNVVSSSTSKEPVKVSRFVPGPLKHHHRRPPLLFADYPKPSTRPPRHN
Signal peptide: MSSIHVASMILLLFLFLHHSDS
Modification: T2 Sulfotyrosine;T10 Hydroxyproline
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004677_AF2.pdb

hor004677_ESM.pdb

Mass:	177892	Formula:	C68H105N23O20
Absent amino acids:	ACEFGILMQVW	Common amino acids:	P
pI:	10.45	Basic residues:	4
Polar residues:	4	Hydrophobic residues:	0
Hydrophobicity:	-248.46	Boman Index:	-6152
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	8460	Extinction Coefficient cystines:	1490
Absorbance 280nm:	124.17